Web Analysis for Richardwakefieldschool - richardwakefieldschool.com
Richard Wakefield C.E. (VC) Primary School pupils aged from 3 to 11 years. Many of the children live in the lovely village of Tutbury about 5 miles from Burton-on-Trent The school has the spectacular setting of Tutbury Castle in the background Peveril Homes housing development in Tutbury
richardwakefieldschool.com is 1 decade 1 year old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, richardwakefieldschool.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | Not Applicable |
Daily Pageviews: | Not Applicable |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | Not Applicable |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | Not Applicable |
H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 69 |
Google Adsense: | Not Applicable | Google Analytics: | UA-16876312-16 |
Websites Hosted on Same IP (i.e. 88.208.252.210)
ΕΚΔΟΤΙΚΟΣ ΟΙΚΟΣ, CHILON ΕΚΔΟΤΙΚΟΣ ΟΙΚΟΣ
ΕΚΔΟΤΙΚΟΣ ΟΙΚΟΣ CHILON. Ο ΕΚΔΟΤΙΚΟΣ ΟΙΚΟΣ CHILON χαιρετίζει το Ελληνικό αναγνωστικό κοινό. ΕΚΔΟΤΙΚΟΣ ΟΙΚΟΣ CHILON με σεβασμό στον αναγνώστη και στον συγγραφέα.
Video Production, Commercials, DP Lighting Camera, Steadicam hire
We are a Singapore based digital content production company specialize in filming, film crews and website video production in Singapore. Visit us to know more.
Camley Street Neighbourhood Forum | Building our neighbourhood plan
HTTP Header Analysis
Server: nginx
Date: Wed, 29 Apr 2015 06:22:37 GMT
Content-Type: text/html
Connection: close
Last-Modified: Sat, 25 Apr 2015 18:12:29 GMT
ETag: "17e709ce-b04d-5149074ae9d40"
Accept-Ranges: bytes
Content-Length: 45133
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.livedns.co.uk | 217.160.81.244 | Germany | |
ns2.livedns.co.uk | 217.160.82.244 | Germany | |
ns3.livedns.co.uk | 185.132.35.244 | Germany |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
richardwakefieldschool.com | A | 3593 |
IP: 88.208.252.210 |
richardwakefieldschool.com | NS | 3599 |
Target: ns2.livedns.co.uk |
richardwakefieldschool.com | NS | 3599 |
Target: ns3.livedns.co.uk |
richardwakefieldschool.com | NS | 3599 |
Target: ns1.livedns.co.uk |
richardwakefieldschool.com | SOA | 3599 |
MNAME: ns1.livedns.co.uk RNAME: admin.richardwakefieldschool.com Serial: 1403927689 Refresh: 10800 Retry: 3600 Expire: 604800 Minimum TTL: 3600 |
richardwakefieldschool.com | MX | 3599 |
Priority: 10 Target: mailserver.richardwakefieldschool.com |
Full WHOIS Lookup
Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.
Domain Name: RICHARDWAKEFIELDSCHOOL.COM
Registrar: TUCOWS DOMAINS INC.
Sponsoring Registrar IANA ID: 69
Whois Server: whois.tucows.com
Referral URL: http://www.tucowsdomains.com
Name Server: NS1.LIVEDNS.CO.UK
Name Server: NS2.LIVEDNS.CO.UK
Name Server: NS3.LIVEDNS.CO.UK
Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Updated Date: 10-mar-2015
Creation Date: 08-mar-2013
Expiration Date: 08-mar-2016
>>> Last update of whois database: Wed, 29 Apr 2015 06:22:28 GMT